PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13158s0186.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARF
Protein Properties Length: 597aa    MW: 67213.5 Da    PI: 7.3521
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13158s0186.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.11.6e-23128228198
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD +vF
  Bostr.13158s0186.1.p 128 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVTRDLHGCEWRFKHIFRGQPRRHLLTTGWSAFVSSKRLVAGDAFVF 214
                           89****************************9543..445569*********************************************** PP

                           EE-SSSEE..EEEEE- CS
                    B3  83 kldgrsefelvvkvfr 98 
                              + +++ l+v+v+r
  Bostr.13158s0186.1.p 215 L--RGENGDLRVGVRR 228
                           *..3488889***998 PP

2Auxin_resp92.66.4e-31254333183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha+ +k++F v+Y+Pr    +F+v v+k+++a+k+ +s+G+Rf+m+fe+e+s+er ++Gt+ g+ dl++ +Wp SkWrsL+
  Bostr.13158s0186.1.p 254 ASHAVGSKTMFVVFYKPRI--CQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTILGTGDLSS-QWPASKWRSLQ 333
                           6899**************8..89*********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-39113257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.2E-38122243IPR015300DNA-binding pseudobarrel domain
CDDcd100177.72E-21126228No hitNo description
SMARTSM010196.7E-20128230IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026128230IPR003340B3 DNA binding domain
PfamPF023622.7E-21128228IPR003340B3 DNA binding domain
PfamPF065072.4E-28254333IPR010525Auxin response factor
PfamPF023092.0E-7485528IPR033389AUX/IAA domain
SuperFamilySSF542771.96E-12491568No hitNo description
PROSITE profilePS5174526.356492584IPR000270PB1 domain
PfamPF023091.0E-5538577IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MASVEGDDDF RSSLSRSYHD QLYAELWKAC AGPLVEVPRA EERVLYFPQG HMEQLVASTN  60
QEIRSEEIPK FNLPPKILCR VLSVTLKAEH ETDEVYAQIT LKPEEHQIEP TSLDPPLVEP  120
AKQIFHSFVK ILTASDTSTH GGFSVLRKHA TECLPALDMT QATPTQELVT RDLHGCEWRF  180
KHIFRGQPRR HLLTTGWSAF VSSKRLVAGD AFVFLRGENG DLRVGVRRLA RHQSTMPTSV  240
ISSQSMHLGV LATASHAVGS KTMFVVFYKP RICQFIVGVN KYMEAIKHGF SLGTRFRMRF  300
EGEESPERIF TGTILGTGDL SSQWPASKWR SLQVQWDEPT TVRRPDRVSP WEIEPFLPTS  360
PISTLAQQPQ SKCKRSRPIE PSVLTPAPPS FLYSFPQSQD PTNASLKLFQ DPSLERNSGG  420
YSSNNSFKAE TPPPPPTPTN CCYRLFGFDL TSNPPAPILP DKQPNDTCGA AKCQEPITPT  480
SINEQKKQQT SRSRTKVQMQ GIAVGRAVDL TLLKSYDEFI KELEKMFEIH GQLRPRDKWV  540
VVFTDDEGDM MLAGDDPWNE FCKMAKKIFI YSSDEVKKMT TKLKLSSSLE NEDCNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1582035617355Auxin response factor 1
4ldw_A1e-1582035617355Auxin response factor 1
4ldw_B1e-1582035617355Auxin response factor 1
4ldx_A1e-1582035617355Auxin response factor 1
4ldx_B1e-1582035617355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3347170.0AF334717.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0597460.0AY059746.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0704630.0AY070463.1 Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete cds.
GenBankAY0913920.0AY091392.1 Arabidopsis thaliana putative auxin response factor protein (At3g61830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292708.10.0hypothetical protein CARUB_v10018954mg
RefseqXP_010512556.10.0PREDICTED: auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLR0FT390.0R0FT39_9BRAS; Auxin response factor
STRINGAT3G61830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18